PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10029367
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 253aa    MW: 28608.1 Da    PI: 7.9872
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10029367genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.99.9e-121149341
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                 i n+  r+  f kR+ g++KK +ELS+LCd+    +i+ 
  Lus10029367 11 IANDVARKACFRKRQSGLIKKVKELSTLCDIPGMCVIYN 49
                 8899***************************75555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-10160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.97154IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-163105IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-6323IPR002100Transcription factor, MADS-box
CDDcd002668.63E-20396No hitNo description
PfamPF003191.3E-121153IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MSRRKRLIRW IANDVARKAC FRKRQSGLIK KVKELSTLCD IPGMCVIYNP VEELSPSQPL  60
QPSDPPTIWP SREVAVQLME RFLALPAVER TKKMTNQLGY LREVVMKAQE KQGQESKKIQ  120
DMEFALLMDE VRYGKGLEGL DMEQCKSLTW LIRFKIQEIR RRMEFLGATQ QVEPHHGPLQ  180
GMNQIVTGTM DHPLQGRNHI VAGTMDHPIY IDEDGGSSSL LDGSEGSTVE TELVPNKHDG  240
MDVELNLGLG RK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110141938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06500.13e-22AGAMOUS-like 96